PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK17504.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB_related
Protein Properties Length: 61aa    MW: 7046.89 Da    PI: 9.9525
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK17504.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding62.96.6e-20956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv+ +++ G g+W++ +r  g++R++k+c++rw +yl
        PK17504.1  9 KGPWTPEEDQKLVKFIQKNGHGSWRALPRLAGLNRCGKSCRLRWTNYL 56
                     79********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.445460IPR017930Myb domain
SuperFamilySSF466895.1E-18560IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.3E-24759IPR009057Homeodomain-like
SMARTSM007176.0E-15858IPR001005SANT/Myb domain
PfamPF002492.4E-18956IPR001005SANT/Myb domain
CDDcd001672.61E-111156No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
CCDESGLKKG PWTPEEDQKL VKFIQKNGHG SWRALPRLAG LNRCGKSCRL RWTNYLRPDI  60
X
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012064723.13e-39PREDICTED: myb-related protein 330
SwissprotO643992e-29MYB34_ARATH; Transcription factor MYB34
SwissprotQ7XBH49e-30MYB4_ORYSJ; Myb-related protein Myb4
TrEMBLA0A067LQI03e-39A0A067LQI0_JATCU; MYB family protein
STRINGVIT_11s0078g00480.t016e-38(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G34670.14e-38myb domain protein 93